DPCstruct | MC6015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5BL71 | 6-104 | LVPPPNKELEAIVGPDVFSKINQIHQSTDTPKVKLQKVDELFASLSDDVLKKIPIPKHLMGLPEDAKKEVHSIMVDKKLTALEKYEK… |
| A0A7I8X5J6 | 21-119 | LPPGFAELLPAESKRKLLELHWDRHLTMEQRGVAIQQVFDKLPQDVLAKLPLPPGLERLPEEYKKKFRELRMDRSITASERVRRVKE… |
| A0A1I8D3D2 | 547-654 | None |
| A0A1I8D6P2 | 37-143 | None |
| A0A6V7U1E4 | 1-109 | None |
| A0A6V7U6G9 | 185-310 | None |
| A0A0K0EEB6 | 155-259 | None |
| A0A2K6WAG1 | 36-161 | None |
| A0A0M3ICG3 | 31-128 | None |
| A0A3P7DX27 | 2-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.