DPCstruct | MC60146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 167 ± 29 aa |
| Standard deviation of domain lengths | 29.39 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4VBK8 | 37-185 | IDLPTKVIEFNKKTLLKIVSVAAVLLLVSSISFGVYSYNLPYSYVNVDINPSLEIVLNIYNRIIDVKALNSEGEKLIEDSYRNSQLN… |
| A0A644YCG7 | 1-158 | MLKNKKIATVIAAAALALGITGVAYSYTAPAKYISFDINPSVELVTNAFDKVIDANALNEDGIKILESLDLENKDVKEAVDLLTQSA… |
| G8LVK4 | 164-381 | None |
| A0A1C5T755 | 2-196 | None |
| A9NF85 | 3-159 | None |
| A0A4R1R7N8 | 24-166 | None |
| A0A7C6HA69 | 5-199 | None |
| A0A264W2D8 | 2-163 | None |
| A0A7G9W3M7 | 6-191 | None |
| G8LXL9 | 57-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.