DPCstruct | MC60133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 264 ± 43 aa |
| Standard deviation of domain lengths | 43.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 12.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419TH88 | 29-258 | VWTKQQEKEWKAFQSFQKDYSLPDGAVERSDRPDVLIHGDKTLGIELTTLYIVDGQVAASEQRQTKPRERVVARAQELHVEAGGRPI… |
| A0A7G5XHK5 | 16-296 | ERLERIDEKSRKKFIKKLKREKDKSNFIAIVTELQCYEFFFNSGFKVEFERGYSVGSKRLTPDFTISKNGQDAIVEVVRLNPTEKDS… |
| A0A538Q029 | 111-401 | None |
| A0A4R4UPM8 | 13-269 | None |
| A0A4Z0VYM0 | 23-260 | None |
| A0A7C0U2M5 | 20-249 | None |
| A0A1G0QZR2 | 4-183 | None |
| A0A7V4D6L2 | 1-199 | None |
| A0A7W0NPN2 | 11-319 | None |
| A0A7Y4XT79 | 65-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.