DPCstruct | MC60128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 157 ± 8 aa |
| Standard deviation of domain lengths | 7.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5RQQ0 | 1-144 | MDFIERITSEIDGECTVKQTSPFTYFAKIKQLKIHFVQIKDYNSAVFQNEIKNLKKKNEHFITVFEDYYKRSPKKTIKRLKYHIGES… |
| A0A1H2DVK5 | 84-237 | IEVADFVRTLTGDVVTSTRSVIAPNELDIYIPSKNIAVEFNGLYWHSEDAGKDRHYHQRKWQRCADKGIQMVTVWEDDWRDRRDICQ… |
| A0A812L9B1 | 230-394 | None |
| A0A842WVS9 | 231-389 | None |
| A0A7C0VYE2 | 286-438 | None |
| A0A1H2DPM1 | 1-170 | None |
| A0A1G3ZLM7 | 200-347 | None |
| A0A292RWZ4 | 124-286 | None |
| A0A5C7LLG7 | 376-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.