DPCstruct | MC6012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 129 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182U146 | 70-196 | HPDRSISRLLLMSYFPSGFWSRLITRVLADDQVVEAVRGLYPLPKDLLDQWPALEETPALAAHWAVWQTGLALHFGPSTVVFKMREI… |
| A0A1I7SKV9 | 1-147 | DVYRRLYLLQYIPPGFWPRLTTRLLNDDKLAQIISGLFVLNDESLSLSLPNECALYADIMDALNTDKGGENRGGFDFLLWQTGVETN… |
| A0A2A4KAR1 | 213-345 | None |
| A0A5S6PRX9 | 1466-1593 | None |
| J9F815 | 903-1030 | None |
| A0A3Q0IZP8 | 626-746 | None |
| A0A815J5R5 | 311-448 | None |
| A7T966 | 152-271 | None |
| A0A0K0D872 | 9-126 | None |
| A0A2G5VN11 | 1092-1220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.