DPCstruct | MC60117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R4ICI9 | 2-154 | PGGSTFRKCPHCMERLNCANRKCTKCGKLLDLKSRQTARMKVFRGQAQEWAKKMKKSRNQAKVFDSSALLVEKLKALGYFPLLLWGK… |
| A0A7J5Z2H1 | 1-135 | MTRPKLRPCPTCQTLNKASIRTCTVCTGPCQEEEIDRKGSDAGWPMGQGVVRNRNVNRIIDSAHIAVLKLEALGFKPILFYGHRDKK… |
| A0A6P6PUH9 | 1-178 | None |
| A0A6P6KKE0 | 1-151 | None |
| A0A498MEW1 | 211-359 | None |
| A0A7J6CR89 | 144-295 | None |
| A0A7J6CM35 | 25-205 | None |
| A0A498LE06 | 1-158 | None |
| A0A5A9PSW0 | 1-153 | None |
| A0A6A5DU12 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.