DPCstruct | MC60116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 105 ± 19 aa |
| Standard deviation of domain lengths | 19.48 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 34.50 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF17780- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R4IAF0 | 1-124 | ADYWKSQPRKFCQYCKCWFVISVSPQSVEFHERGKNHKENVAAKIQEIRKKSVAKAKQEKKMSKDFAAMEDAAQKAYEEDLKRLAGH… |
| A0A0B2QZU5 | 1-83 | MTEYWVSQGNKWCDFCKIYISNNPGSIRNHELGQRHKDNVSKRLAAMRKDNIAKEKEQKETARAIEQIEAKAQRSYQKDKAKF |
| A0A6P4YW25 | 1-109 | None |
| A0A4T0I6K5 | 2-136 | None |
| I4Y8H6 | 1-92 | None |
| A0A4S8JDV2 | 1-83 | None |
| A0A2Z6NKN4 | 1-73 | None |
| A0A2I0AJ25 | 60-199 | None |
| A0A1Y3ER59 | 1-94 | None |
| A0A7J7N634 | 106-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.