DPCstruct | MC6011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8VBW0 | 460-569 | SVPSQVNQLDNNSNNVDSEDLSQGSVVETLSTQFNDVDSIYPSLIHCQHPIESLVPLLVEPMWTNQLTKTFHNRLISTVGDLALQTE… |
| A0A444TFW2 | 91-193 | VMNSAPQLELENVQNSQDDEEISMKMPNCSQPIFSSLVDCEDPIDKILPKLTSSSLAESLKAVFKDRDIETVGDLCSLSEKELTSLP… |
| A0A1I7V4N2 | 153-268 | None |
| A0A814MC49 | 74-160 | None |
| A0A2A2KF52 | 639-749 | None |
| A0A820KJE5 | 1-94 | None |
| A0A2J7QI86 | 246-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.