DPCstruct | MC60109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 8.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.15 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0163- PF07331 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N0I3A6 | 1-82 | MLKQEDIDLVSLASPHIMDSDEEGLNRTLELLEAYDIYSIGAGNKQINAENPFVIYVNNQRYMIFNAHFYQSDNYCFLVVML |
| A0A399VBV3 | 195-276 | VPPEIARDLAGVGYDACSTASNHSLDDGGDGVDRTLDTLDAAGLAHAGTARSAAEAATPTLVERAGVTVGLVSATYGLNGSP |
| A0A503WEJ5 | 9-85 | None |
| A0A2N5KSN0 | 18-116 | None |
| A0A0Q5NQU9 | 1-81 | None |
| X5PV71 | 28-98 | None |
| A0A846AG38 | 2-75 | None |
| C0FVV4 | 170-239 | None |
| A0A1B2EEF0 | 66-154 | None |
| D4KJ87 | 202-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.