DPCstruct | MC60098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 271 ± 51 aa |
| Standard deviation of domain lengths | 50.64 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.98 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5IQX7 | 33-311 | GKNICLANKETLIAGGPAIVPLAVKHGVKILPADSEHSALFQCIQGMPEGALRRIILTASGGAFRDMDLATMRELAVSDPAALHKKA… |
| A0A2V2EX02 | 74-371 | EILEHAFDGADVALIAAGGFAGLAYTLRAARLGIKIALANKESLVCGGELVLNAVKKSGSDLVPVDSEHSALFQALSFRRDTPFERL… |
| A0A835FZQ5 | 70-355 | None |
| J9Z0R9 | 19-281 | None |
| A0A7J7N048 | 178-358 | None |
| A0A832FSE4 | 2-266 | None |
| A0A811P1F4 | 111-470 | None |
| A0A836RKC9 | 32-253 | None |
| A0A2V6H0K4 | 85-395 | None |
| A0A7V5C3S6 | 79-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.