DPCstruct | MC6009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 587 ± 59 aa |
| Standard deviation of domain lengths | 58.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370DGI3 | 1-655 | MEISAREIILRKIAAVEQKITRLQKQQEESETTLRSLRECLALGDDETTHKPKHPAEAPVSAEENLGNCSMHCSTSCIPAVVTPDEK… |
| A0A450ZL79 | 1-593 | MGQPNSQHTADELLAIHARLTELEAERQRLLRRKRILQQRQAKFITPSLASSNQLGAAQKVALFRDLFKGRSDVFARRWENPGKGRS… |
| A0A0U4NIA1 | 2-489 | None |
| A0A1G4QR37 | 2-663 | None |
| A0A244CCU1 | 8-547 | None |
| A0A1W2G5X7 | 1-521 | None |
| A0A1Y4TPD4 | 1-656 | None |
| A0A3M9NM62 | 2-541 | None |
| A0A855UL28 | 4-608 | None |
| A0A321LKF2 | 1-613 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.