DPCstruct | MC60086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 53.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820RDV7 | 1-116 | ERSCAKRTGASKGTSRETVWGVLTGQACECTSNLVGHEVREIETWILRLLSAPVSIPGKTKILIETLPNEPPMLFALPDHTRFSLVD… |
| A0A6V7TJJ2 | 26-126 | VWTVLAGHWPQGMSIPMPVMQELRQLETWLFTLLSSPVPVPGNTKLLLEVLPSDMMPSPLEFALPDYTRFSLVDFPLHLPLELLGVE… |
| A0A368F864 | 65-164 | None |
| F4WEB7 | 204-316 | None |
| A0A2H1BW91 | 1-118 | None |
| O08873 | 209-320 | None |
| A0A060Z7B8 | 1-104 | None |
| A0A4W3GL02 | 218-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.