DPCstruct | MC60083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 48.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820QS93 | 1-82 | MKWFGKSYSDFQIIEGDFFDKNFRSILKSGNVIFVNNKTFSNDKNHNLKLCFYDLQSGSRIISTKPFIESNNRVTARNINGK |
| M5BKS7 | 28-108 | DREFNYRLEMWDLCCSEYKHIAGDMLESKEVVEWIRKADVILVNNFVFEELLNERLTCLFLDARDGTQIVSLKCFLDRGFK |
| A0A183N5E5 | 238-301 | None |
| A0A131ZYT4 | 1-84 | None |
| A0A7R9J1P6 | 132-211 | None |
| A0A1B6E1Y7 | 198-277 | None |
| A0A5S6QQN4 | 208-287 | None |
| Q8INR6 | 205-284 | None |
| A0A3P7MU35 | 201-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.