DPCstruct | MC60079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 8.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820Q311 | 1-95 | MPLEGYTVDYAEPDNGLVMNDAKYFFKAVREGDVVTFATNEENERHSWVQALYRATGQSHKPTPPVTITNKPSQGASGSGQRDPAGQ… |
| A0A6P4KYF0 | 155-237 | YKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRFFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPVT |
| A0A498MPR6 | 394-479 | None |
| A0A816RV47 | 294-386 | None |
| A0A820HAF4 | 1-81 | None |
| A0A7R9CHH3 | 33-132 | None |
| A0A819XNM7 | 16-96 | None |
| G3P1H4 | 317-415 | None |
| A0A819E8V6 | 72-149 | None |
| A0A663N9W0 | 35-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.