DPCstruct | MC60078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 110 ± 20 aa |
| Standard deviation of domain lengths | 19.92 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF10211- CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820Q042 | 2-108 | GTSKQTTGLDQQMMDVTGAGGSSNSPRLGKKQATMKDLSLEEILDKILPPKITKDPNNPDLLYCQRISSTPSTRLDVINLQEQLDMR… |
| A0A815R4H1 | 1-79 | MKDLSLEEILDKILPPKITKDPNNPDLLYYQRISPTPSTRLDVINLQEQLDMHLQQRQARETGICPVRRELFSQCFDEL |
| G0QNM2 | 19-125 | None |
| A0A7J6SEB4 | 11-143 | None |
| V5B6H0 | 45-151 | None |
| B4DSU3 | 7-132 | None |
| A0A0P1AFR1 | 38-151 | None |
| A0A3P7MVU0 | 13-112 | None |
| A0A4S2LEX9 | 2-125 | None |
| A0A2B4RIS8 | 237-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.