DPCstruct | MC60076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183P1P4 | 124-211 | EKIRVEIQSISGSWSYVCTEVTDSSGRIRFSLPEQIHLPDGLYPIKMTAESDPDHPVIITLAIVPPQTEVVVFSVDGSFAASLSLMGK |
| A0A820PYS3 | 1-108 | MVCLANEKVDIYVMRSAPYGEWTLVDTLETDTHGRIRYTIPDDKKLPLGIHPVKCVVRGDHTTVDLHLTVLPPKSEAVIFSVDGSFT… |
| A0A132A2J3 | 8-112 | None |
| A0A183S2N0 | 1-98 | None |
| A0A7R9AY14 | 132-238 | None |
| A0A820MRU8 | 1-106 | None |
| A0A1B6IZQ4 | 13-105 | None |
| A0A818NIB8 | 216-318 | None |
| A0A4Y2FPV0 | 982-1085 | None |
| A0A3S5FET4 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.