DPCstruct | MC60075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820PX68 | 1-93 | TSKCPIKKYKAGKYIVGDQLLVHDDFKDRVTSLESVAKTCKVHIYVKGTYYQLQNPAQQVLVADADVVIGHGFNFEMRDENNALICN… |
| A0A815P6X5 | 24-115 | KPKCPIKVYKSSKYITGDTLLLHENFHPRVKPLENVAQGCKVHLYIKGSYYQLRDPAQQVLVSEADVVIGHGFQFELRDEKNALLCN… |
| F6YJQ4 | 123-215 | None |
| A0A3Q9DBI9 | 113-199 | None |
| A0A815LNN8 | 22-132 | None |
| A0A6P4Y7E9 | 681-772 | None |
| A0A821WPV2 | 1-94 | None |
| A0A813UQB0 | 34-144 | None |
| A0A818SXM1 | 302-392 | None |
| A0A820X1H3 | 22-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.