DPCstruct | MC6007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1Q7Z5 | 1-65 | MTPVQLYRNLLRNVRKLPKESQSHYRHYIRQNFNSHTDETDPERIKQIMSKAIQDMQWLLEKVSQ |
| A0A3Q2WST6 | 79-153 | MPPLAGAELVHTPLQLYRYLLRCCRQLPSTAMQQHYRHAIRQGYNSHSDEDDPERTQMIIQRAIADADWILDKYT |
| A0A834Y0Q9 | 1-74 | None |
| A0A4W4E3Z0 | 3-71 | None |
| A0A4W6CLK5 | 1-77 | None |
| A0A0R3T8R0 | 555-631 | None |
| A0A6J0HSI6 | 1-83 | None |
| A0A7R9FPP6 | 65-141 | None |
| A0A6P8N4M9 | 12-73 | None |
| A0A6J3HDW6 | 11-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.