DPCstruct | MC60068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8Y8U2 | 402-509 | EEEEIFNIWTAYLNMEVAYGDDNSAREVFQRSCSNADALKMHKQMAAILFDSGKIDEADEVYEAMLKKFRADSDDVWTLYGEHLMKT… |
| B3SB30 | 56-159 | SQHLLNIWIAMMNLENLYGTQETLTKVFERAVQRNDPKDVFFHLSRIYIRSDKHELADKLFQNMIKRFNTSKKVWIRYGQFLFEIKK… |
| A0A6A4GUU8 | 325-449 | None |
| A0A507CKV8 | 146-270 | None |
| A0A0P4VYN1 | 676-798 | None |
| Q4UGH8 | 70-192 | None |
| A0A2P6VFP8 | 160-264 | None |
| A0A2G4T3P9 | 24-151 | None |
| A0A3S2MVZ6 | 781-885 | None |
| A0A0M3K3K4 | 92-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.