DPCstruct | MC60066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 4.36 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 54.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2G2D6 | 852-923 | WWLSPELYMRRPPAISQKWRLDRLLKRKAEEGVKIFVIVYRNIDAAIPIDSQYTKFSLLDLHPNIFVQRSPN |
| A0A7N0VHI7 | 69-140 | WWLCPELYLRRPFQNHASSRLDSLLEAKAKQGVQIYILLYKEVSIALKINSHYSKRKLLEIHENVKVVRYPD |
| A0A2H2IEF3 | 555-625 | None |
| A0A556TYL6 | 122-191 | None |
| S4RLG8 | 335-414 | None |
| A0A654GTA2 | 620-701 | None |
| A0A182TH68 | 497-572 | None |
| A0A438NJV0 | 102-179 | None |
| A0A815WIB1 | 111-185 | None |
| A0A6I9MWE2 | 23-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.