DPCstruct | MC60064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 14.16 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 65.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 50.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815H417 | 70-148 | ILLSIISNSTLSISIQRIYIDGAKSVFFDLISKWIFQENLICFINLKSLILTRCYLSEILINNLSLLIQYQLDELILTI |
| A0A819D8N1 | 6-99 | ILFPLILNSSSLTSSIKFIHVDDDNSISCDLIYKDIFYQDNKVNIFFPNLQSLSITSCLLSKPLIEILYELSQYQLNELTLTITEDL… |
| A0A817H9I1 | 183-254 | None |
| A0A816R118 | 187-298 | None |
| A0A821P396 | 264-385 | None |
| A0A821AX86 | 4-103 | None |
| A0A818MYL1 | 26-125 | None |
| A0A815QVR9 | 19-130 | None |
| A0A817L726 | 152-250 | None |
| A0A814BTT1 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.