DPCstruct | MC60062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 64.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819D333 | 1-140 | MRYDDELKYDQKTYMPNPIRCIVLSIALIYYFRLPTNEDNIQRNDKKTPSREQLSEVLCKTIPNFDQIIQNELEQFVNTNNFFIPQG… |
| A0A817XZE5 | 63-177 | MRYDDEINDHEIQYQSRAKQCIALALALTYYFRLPTAEDNLQRNDTQTPTREELDQLLSNIIPDFSDMIEQELERFVNTNNFVFPEG… |
| A0A822D8F4 | 222-336 | None |
| A0A817P303 | 1-118 | None |
| A0A815WBP5 | 5-104 | None |
| A0A821HE47 | 1-177 | None |
| A0A815F8Y3 | 1-120 | None |
| A0A820Q9W5 | 291-408 | None |
| A0A821DY11 | 1-122 | None |
| A0A817K6T1 | 136-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.