DPCstruct | MC6006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9KYI9 | 3-79 | TVNIGYNNSVVLLRIVAVINAEGNAARKLRTGAYSKFKLVEATKGKKTRSMIVMDSGHLVLSILTCETLNERIKRAD |
| A0A096CQD2 | 1-79 | MYLDVGFGYKLAVNEIYALLPINILSVKNLALEKRKQGKMIRATKGRKGRSLLLLKNGMVCVSAYTTDEIVNNIHELNI |
| B5Y9P7 | 4-86 | None |
| A0A3A4UG59 | 1-81 | None |
| A0A1G6N3N6 | 1-97 | None |
| A0A164QF36 | 173-246 | None |
| A0A4R4AJJ0 | 2-70 | None |
| A0A7C6KIY4 | 5-86 | None |
| A0A3C0NYJ3 | 1-61 | None |
| E6SK06 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.