DPCstruct | MC60055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0ARP2 | 1-116 | MNIQNDKWNDANQIRFTLNVGIFTDAFWLKSLDFKKTGIIPTFPKEYECAIRERIGDLLPVKEDKWYCITSGTDVMKLWSEIERDLN… |
| A0A1L3KYI3 | 237-335 | TEGVVQVISVQRSMNNTELNSRFTINVGVTPDTRPANTRLAEHECRSRLRIGFLRAERQDHWYRYRPRDPASVRRAVAEARADVEAY… |
| A0A2B9B9H2 | 6-98 | None |
| A0A412EWC9 | 26-118 | None |
| A0A7I7WGS3 | 64-162 | None |
| A0A4P5XG49 | 97-190 | None |
| A0A7V3RQP6 | 35-135 | None |
| A0A2U8E382 | 96-196 | None |
| A0A4P6U3R8 | 156-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.