DPCstruct | MC60050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2BN73 | 6-84 | IEIYASKNHSEKTNGYRHMVIEARLIEILGKDFKNEIIALKKRGLKTEPAFAKQLGLKGNPYESLLELEEYYDDDLKNL |
| A0A317J1L7 | 85-173 | LVSFFSHNFRVGIFGQGRAIEEQAAYIHMKIEERLLQIGGETAREGIRDLKRKGFKTEPAFAVYFDLPGDPYQALLDLAQYSEAELQ… |
| A0A3E0NNG5 | 103-193 | None |
| A0A4P8RC32 | 1-80 | None |
| A0A0A1MTQ5 | 39-133 | None |
| A0A1B3N524 | 205-295 | None |
| U1H9D7 | 12-90 | None |
| W8ZLL6 | 85-181 | None |
| A0A6P0TK87 | 11-88 | None |
| A0A6M1NHW1 | 16-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.