DPCstruct | MC6005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 170 ± 25 aa |
| Standard deviation of domain lengths | 24.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6FJ74 | 4-132 | LHLLSLAIALIAIVIADRQAFAWMTGKTAKIPRGSLHLVHNAVWIGLGGLIASGIFLAYPMINYLIKEPAFIIKMMFVGILVSNGFL… |
| A0A0G1VGH3 | 8-195 | HPLFVIFHILGVAFGAGAGFVADVLFFSSIKKREFTEEKVKTIGLVSKMVWLGIAIILVSGILLVLSEPGILQSAKFWAKMTVVGIL… |
| A0A366W8P9 | 3-188 | None |
| A0A3A4JS46 | 9-147 | None |
| A0A059KXD1 | 1-149 | None |
| A0A1F6FRC9 | 1-174 | None |
| E2CBU9 | 150-341 | None |
| A0A7T9FF84 | 1-143 | None |
| A0A7W1SRH2 | 5-133 | None |
| A0A2A9KC24 | 5-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.