DPCstruct | MC6004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.95 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q2X9Q5 | 1-72 | MPDQPSPPDPGYDDSGVPTFDSVREKIETRFGAAQGAEELAAETAEGRSLEEQYEERQRAAAERLAKIRESM |
| A0A5C7WNG7 | 2-68 | PDTGYTPDGVPTLEGVREKIESRYGTALGATELAQETPEGRALTERYDAMQKAAAEKLEEIRASMTK |
| A0A541AZN0 | 11-90 | None |
| A0A1G6Z927 | 43-121 | None |
| A0A100WHX9 | 2-76 | None |
| A0A4P7HIB7 | 9-93 | None |
| A0A8A6RVS4 | 56-130 | None |
| A0A143QE13 | 80-148 | None |
| A0A1G8CGB4 | 88-151 | None |
| A0A132PIC0 | 23-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.