DPCstruct | MC60023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 110 ± 17 aa |
| Standard deviation of domain lengths | 16.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.99 |
| Pfam Score | 94.00 |
| Assigned Pfam label(s) | PF00696- CL0052- PF00206- PF04750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4V008 | 2-77 | YAEDIEGSKAYAHALQNINLLTEDEEAQICQGLDKIRIEWDNTEFVTLSEDEDIHSSNERRLKELIGEPATKLHVG |
| A0A7J6IL83 | 1-91 | MAENKLWEGRFTALSQQGIYGSIAFARANFNNGILTQHKFEEIERGLLEVGKEWEAANFKIVQGNEDTHAANERRLGEIIGKDVAGK… |
| A0A668VG40 | 2-76 | None |
| A0A833V1R0 | 318-420 | None |
| A0A535RHL1 | 24-128 | None |
| A0A444UC75 | 80-182 | None |
| A0A812S2A7 | 2-118 | None |
| A0A438F8M3 | 1-132 | None |
| A0A835TIK4 | 164-258 | None |
| A0A267FNY7 | 13-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.