DPCstruct | MC60022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 140 ± 24 aa |
| Standard deviation of domain lengths | 24.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6NYT2 | 7-119 | ARVDFDDIYQSGHAMEKHMILQHPVTDRWYILRCQHMHFGLKPVVGAMRHLVGGEHGPSATRADAIRILGIGVENCNSDKSKRNNNI… |
| A0A430LPG0 | 65-206 | DSHVEDTIVCAPVGRNLRPRRQLSHAKRRVTFDEVFQDGNAAVKHFIVQVPSSDGLWYILHCDEHEQAFQHPALRGAAAHLKGSKHG… |
| L2FWQ9 | 339-481 | None |
| L2GC47 | 1-114 | None |
| A0A545VH88 | 224-387 | None |
| A0A4V6J993 | 209-393 | None |
| A0A428NU49 | 1-115 | None |
| T0JPK1 | 332-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.