DPCstruct | MC60019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 664 ± 113 aa |
| Standard deviation of domain lengths | 112.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05478 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q21571 | 56-682 | GTGKGISDSLQKTPDSKSYEDLNNLISGKESYGETLKSMILSQVTAIVFWSVGIVLIIIAAALCIVTCIWQCCSTCAPRESAVRSEY… |
| A0A5K3FR57 | 1-663 | MRLVTLHKRFLCSIWVSVLFYFNFSADPKNYELPALMITPIFKHFPGYMACLIFGILFAILMPMIGIFFCCLRCCGRCGGRVTQMDR… |
| A0A0V0QH52 | 383-1119 | None |
| A0A226F1F7 | 28-606 | None |
| T1KVV9 | 2-543 | None |
| A0A183T2R6 | 99-659 | None |
| A0A498MS93 | 405-979 | None |
| W5JI92 | 50-941 | None |
| W8ASN3 | 46-849 | None |
| B4J4U9 | 3-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.