DPCstruct | MC60018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 171 ± 31 aa |
| Standard deviation of domain lengths | 30.51 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7E6D9 | 567-743 | MNQFRMLFSTCKVPGVTRDSVVNYFRTESEGVTPIHIAVLCRGRVFVFDVMHDGGMLTPPELLRQLTYIQTTCCREADGPGVAALTT… |
| A0A5K3FPI4 | 3-168 | QYRNLFNSSRIPGEVVDRHATFMESRHIVVISKGKFYTFDVFNEQDDQIPSEQLVSNLELIRNQPEHAAERPSVGVVTAMDRDSAAL… |
| A0A819TAP7 | 216-333 | None |
| A0A817PKP6 | 537-707 | None |
| A0A2C9JTD0 | 62-256 | None |
| A0A4Y2U3B2 | 81-251 | None |
| A0A1I8HYW7 | 458-637 | None |
| A0A1I8ITG7 | 1-158 | None |
| A0A7M3RLU2 | 97-313 | None |
| H3AEI2 | 266-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.