DPCstruct | MC60016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 274 ± 40 aa |
| Standard deviation of domain lengths | 40.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 79.67 |
| Assigned Pfam label(s) | PF11464- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3FHY2 | 92-393 | ICADCSYFLSKHDVRQIVEACDWAAASDSKNTILPPDLIPSIKDNILKRGVSYLSRSSSGTSLDSIVQKRSNPPDLRICGVCKSILE… |
| Q59UQ8 | 209-432 | CSMNVPLVKLVEKLPQLNYTHEYEEIDENLRFRCCIDCKNSLLFDWKRNLDSDNKVLTMYEAMLLQRQQIEKLMPQYEQLVGDNDDS… |
| A0A044TK85 | 269-586 | None |
| A0A1J8Q3J4 | 823-1109 | None |
| A0A094J8B3 | 384-645 | None |
| H3ALD8 | 223-519 | None |
| A0A6V7HG83 | 1-356 | None |
| A0A2A9NSL3 | 90-405 | None |
| A0A3P7FUJ8 | 7-292 | None |
| G0SG26 | 347-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.