DPCstruct | MC60010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 239 ± 46 aa |
| Standard deviation of domain lengths | 45.78 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445MYA2 | 19-280 | ITSSAYDFNTVHPAINEYAVNQSDLEDILINRLGFSKGIETVFQKEFDKMTIVQWVQLGGRMEDQPESRGVEHFFDPFETWDDAGLS… |
| A0A1G1G2B8 | 21-276 | SHVLALQEETHRAININIAERTINGFSLDTYLIHNLGFIDGYKQKFGGVNASGGRVNQSIAEWLGYGGIQEDRPGSITDYIQNKPTR… |
| A0A7T5RJY1 | 1-194 | None |
| A0A5K7YVZ6 | 10-279 | None |
| A0A7C4EQV8 | 2-180 | None |
| A0A5S9NVK2 | 22-272 | None |
| A0A554MCW5 | 1-184 | None |
| A0A7Y3U694 | 61-348 | None |
| A0A1V4XJF3 | 16-289 | None |
| A0A7J2KSF6 | 17-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.