DPCstruct | MC6001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 187 ± 28 aa |
| Standard deviation of domain lengths | 28.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653Q591 | 1-194 | MRHGDLFSSEIRSGDTVLLIDGLYHHNPALRHKEILDALARGVHVAGASSIGAMRAAELDDFGMTGHGAIYQDYRSGTIDGDDEVAV… |
| A0A010YLN3 | 28-212 | IARGDVDAVLARPEPPAAIGIVDGRFLSAFSISPKEVLRALDAGVAVYGASSMGALRAAECAPYGMIGVGAIYAEYASGRLDADDEV… |
| A0A7G8HLC9 | 22-213 | None |
| W4VCQ2 | 1-124 | None |
| A0A833IS32 | 80-270 | None |
| A0A5D0U983 | 82-283 | None |
| A0A150HXK7 | 27-233 | None |
| A0A2A9FGY3 | 20-227 | None |
| A0A7X6CIY9 | 61-277 | None |
| A0A841CNE8 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.