DPCstruct | MC60008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02342 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A659ARA1 | 75-171 | VDLEALNPAVERISFAVNIFEAEARNQNFGIIEDCGIRIDDQESGETQSSYDLTEDYCQYTAVLVAEMYKKDGKWKFVAKGEGLKGG… |
| A0A7Z8G942 | 11-103 | VPAEVKKLVFAVTIYDAENRKQNFGMVSNSFMRVYNNDNNTEIARFDLSEDASTETAMIFGELYRHGSDWKFKAVGQGFAGGLGALA… |
| A0A355TQ32 | 415-507 | None |
| A0A7S1KE44 | 6-98 | None |
| A0A6I1Z111 | 235-324 | None |
| A0A450ML91 | 87-206 | None |
| P18778 | 27-119 | None |
| A0A377LNA5 | 3-85 | None |
| A0A542TIA9 | 95-186 | None |
| A0A7L7MDX2 | 85-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.