DPCstruct | MC60007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 82 ± 15 aa |
| Standard deviation of domain lengths | 15.07 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.30 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0310- CL0671- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8D3I7 | 5-84 | QRSGKLNTYLSSKEIEHFCQLHTEDALFLEETLNKLGLSIRAWHKILRVSRTIADLENEQKIQRNHLIEALSFRAMDRLM |
| A0A4U1GRA1 | 14-104 | SATIRARVVKAREPQRHRFERGEASAPVNGRLSVVDLERVAAPDRGGRRMLDLAEFPPELRGKVLRVARTIADLAGSDSVRVSHVEE… |
| A0A4Q5XZ51 | 57-130 | None |
| A0A645J6B6 | 18-115 | None |
| A0A259LU39 | 177-259 | None |
| A0A0P7Z4A3 | 252-329 | None |
| A0A246BCV3 | 636-722 | None |
| A0A7X8J0B4 | 2-97 | None |
| A0A2V9L9P0 | 31-99 | None |
| A0A139BPD8 | 3-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.