DPCstruct | MC6000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HZ90 | 4-72 | VLERWRNAKSGERYLRVYFQAQGLDDLRRLQTPDAQHPMLRQEWRQPGCRQTDVGTLCPFQAAITALGQ |
| A0A379Z427 | 1-69 | MFQRWRDAQNNRELLKIEYVYQSTEQLRKATPLTLQTPPQRVTLALKGCPIDKDGFCAWSDFEKTMKGI |
| A0A1T4VXK0 | 121-191 | None |
| A0A821UB81 | 196-262 | None |
| A0A1I5S4Z6 | 58-129 | None |
| A0A212ETT3 | 49-119 | None |
| A0A212F472 | 462-528 | None |
| A0A7I0ZXQ9 | 173-230 | None |
| A0A4Q1B7H1 | 36-105 | None |
| H9JNU6 | 104-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.