DPCstruct | MC60
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.02 |
| Pfam Score | 94.77 |
| Assigned Pfam label(s) | PF03470- CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9SBT8 | 4-105 | SDSEGYDSEELDFDELTEAHGEASAGLKDGTLKFANVDGTFRCPYSPARKKQDYKYREILQHAVGVGAGHRGPVAAGQHRALREYLE… |
| A0A162AIN7 | 1-108 | MDSNSESDITDSEIDEYKEKPYSLLKDGILKVKRSDGSLKCPFCPGKKKQVYGRKDLLQHAQGIGSSSSYKRTAKAKAKHLALAAYL… |
| A0A427B708 | 71-171 | None |
| A0A287XW07 | 44-141 | None |
| A0A443NDX2 | 1-108 | None |
| A0A2K1ISQ2 | 6-108 | None |
| M4E1J9 | 2-96 | None |
| A0A453MBT7 | 313-416 | None |
| A0A438JFT0 | 1-108 | None |
| A0A3B5ZYZ2 | 119-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.