DPCstruct | MC6
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 243 ± 19 aa |
| Standard deviation of domain lengths | 19.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498MUP9 | 491-749 | NNTNVDFTQSTDDDPLIDGPLISQDTLESVIKREFKKLPTHWAVGVISFLHVVYVVVCILITVFCWLSDEHTPECTAALQGIDSKTV… |
| A0A182N6M6 | 5-230 | ILATEDDDGFRPLRTVPAFSIHLLVSSCISLTGIILAATWEDSRRCEAYFIMLYLRAAFWIFTYLFNHIVNAHHEKLRLNGYHDFHR… |
| A0A446X615 | 18-245 | None |
| A0A0P4WDG5 | 3-256 | None |
| A0A6P9BBU2 | 6-248 | None |
| A0A818A633 | 259-513 | None |
| A0A4Z2B0S3 | 207-441 | None |
| A0A7R9A372 | 14-267 | None |
| A0A1J1IP61 | 7-228 | None |
| J9JKJ3 | 17-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.