DPCstruct | MC59998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 202 ± 42 aa |
| Standard deviation of domain lengths | 42.26 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 83.81 |
| Assigned Pfam label(s) | CL0306- PF02840 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2MTX0 | 18-187 | RESVATAAQFVQHFARFTIGAWRRELQRPVPFEGKVLQETELAVFRSRQSLQQIERAVAPLIQQLERNEANEEVVKQLDAMVTLAAQ… |
| A9V6H9 | 49-258 | ERQRNELKEALENVDAMIMNEMLQHGEGTTTKYEVKYTWRDMQQLGLQLGKDDSKDAVLCRRFLRHMLTQWGSDLEHRDDELKQSSE… |
| A0A1Q9CIP5 | 81-257 | None |
| A0A0C2MMC8 | 49-202 | None |
| A0A7J6Q113 | 573-791 | None |
| A0A0A8L5G0 | 11-151 | None |
| A0A4V1XS52 | 34-224 | None |
| A0A183J7R0 | 25-184 | None |
| A0A066WQZ5 | 156-390 | None |
| A0A7S0J483 | 20-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.