DPCstruct | MC59995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07222 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8RWJ8 | 34-127 | FSNPKPGSPLSDQEYEQFFEHLTPKLRAKALCKKRMAYGCDHPKIQDFDLKENHGIIPKGTVCTDFIFFHHFKSFCQFAKFRCSNKL… |
| A0A6P9AL67 | 20-134 | HPAILVLLICAFSKWLLATDIQTQDPSLAGTPLSDAEYDNFFKTLNNPRRASAVCFFRSMYGCQNPLVQTLDLYENHGIVPEGRVCS… |
| A0A3L8SGH7 | 1-122 | None |
| A0A6I8QFJ6 | 25-141 | None |
| A0A6J0WBD4 | 19-126 | None |
| M7BQD7 | 1-105 | None |
| A0A485MK10 | 18-142 | None |
| A0A6J0GAP4 | 1-136 | None |
| A0A667H3P0 | 1-130 | None |
| A0A1S3AM28 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.