DPCstruct | MC5999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17948 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7PSQ9 | 1-101 | KVRSPLPERPFQMHLQWRPDEELPALARLCGVIDASYNEEDLGEFIAYWLGRPEVFDSQHQWMLKFIRALKTRRYVRRQPMEAKGYQ… |
| A0A345ISC7 | 41-131 | GKFTMHNGWQPGADFQRMAATWGMKIAEPVTPEELQEFIGYWEPEGKAFHQAQWEQKLARSVLMSRARKTTGVKNHETGKRPDGTTG… |
| A0A7H4MSJ7 | 188-284 | None |
| A0A1T4UZ37 | 101-198 | None |
| A0A7S7FB56 | 60-171 | None |
| A0A1G0DML9 | 110-235 | None |
| K4Y5P6 | 188-275 | None |
| A0A6D0M2B5 | 1-87 | None |
| A0A2X3CDU5 | 1-99 | None |
| A0A2X5NDT0 | 167-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.