DPCstruct | MC59989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 517 |
|---|---|
| Mean domain length (aa) | 165 ± 35 aa |
| Standard deviation of domain lengths | 35.01 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 96.30 |
| Assigned Pfam label(s) | PF05199- CL0063- CL0221- PF00696- CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9K795 | 33-194 | PPNMLAYGHGYSLNIILLRPKSRGSVTINIDDPFKPPQVDLKLLSKIKDLETLLIALKEGRRILRTPAFGPMRAVEVRPEPSIESDE… |
| A0A1I7EGC0 | 66-222 | LVGAELDAEIRKRTIHGVDLSISLEPLPDPKNRVTLSTTRRDPHGIACPDVYYDVGDYVRKGYEASVAQLKQIAGLFNATELNITTA… |
| F4PK63 | 6-179 | None |
| A0A1R3KAB8 | 18-180 | None |
| A0A438MZZ3 | 715-895 | None |
| A0A2H3CS12 | 1-174 | None |
| A0A6A6LJ66 | 1068-1236 | None |
| A0A7V8VJ35 | 8-144 | None |
| A0A226F233 | 245-367 | None |
| A0A812NIP4 | 337-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.