DPCstruct | MC59987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 235 ± 40 aa |
| Standard deviation of domain lengths | 39.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9LF90 | 21-257 | CPSKRIKNLPEVDTTTVKGPDRPTGTPDPAGTTVSGGGATYTVVSHQELPHWSTQHFVKSLQSFRLGCEKLKNRAGWQDVCAQAMQT… |
| A0A7Z9K590 | 50-310 | LWIEIIFFVLPLVSCSQYFSSPPKLLLLTPKPGATLTMVGFEQLLGWGAGRENQALAAFLKSCKKLSKLPADAFFLENKTEAPSKVY… |
| A0A3E0NMD3 | 181-468 | None |
| A0A365VPN6 | 7-177 | None |
| A0A1Q7BQE9 | 5-248 | None |
| A0A1I9YME9 | 45-314 | None |
| A0A2C6IC06 | 1-233 | None |
| A0A3S4HHG2 | 47-292 | None |
| A0A5B8XKM8 | 179-388 | None |
| A0A5A7N3D5 | 13-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.