DPCstruct | MC59986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9IUM6 | 7-134 | HMILPEQISNEPIGPMVAHGDDNWRDVVFWVLNALVAAEEMGITSSNVDTMRSTSKNAFVQRLLGVKAKFGSKIGLSKDWAYNAIKA… |
| A0A0A8RAN1 | 363-485 | PEVISKEPLGPAVRQGDEAWFNIVRWTLYGLLNAEELGVTSSNVERQARDSRNPDVARLLGSEGDAGKDLQLPRDWVVQMVRQVGNY… |
| A0A7W1TQ88 | 631-731 | None |
| A0A0H2MGI2 | 205-314 | None |
| R5E883 | 120-242 | None |
| A0A381INB4 | 57-183 | None |
| A0A2E9M3F1 | 402-536 | None |
| A0A1B7VFY7 | 345-442 | None |
| A0A2N0LYC4 | 1-104 | None |
| A0A6I4ZS96 | 396-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.