DPCstruct | MC59983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 63.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A545A5H1 | 13-66 | SKLKAQYESKRPGEYMDPCQDAASKSMKCLHRNGGDKEMCTDYFQTYRDCKKQW |
| L2GB58 | 16-79 | DEGFKESSRKFDAKDKSEYFDPCQEFAQKSIRCLHRNGGDRSMCGDYFQAYRDCKKAWFEKKKE |
| A0A0N1P3M1 | 12-85 | None |
| G4MMC1 | 48-110 | None |
| F2SGW3 | 1-68 | None |
| Q0CLH5 | 91-150 | None |
| A0A7U2MLG2 | 65-126 | None |
| W7HPV2 | 14-72 | None |
| A0A6A7BTF1 | 1-63 | None |
| G2R7G6 | 3-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.