DPCstruct | MC59981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 240 ± 46 aa |
| Standard deviation of domain lengths | 46.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0724- CL0525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A544ZSA7 | 15-252 | QALLREQGFRPMYFSQKTNMFNVYFVKRGWAWVSLVIFAFASTYPDMSNGQRARALLRWGANTLWWFLVTQWFFGAPIIDRGFRWTG… |
| A0A1Y1Z2L8 | 12-221 | LVQYIHPAHESYFSDKRNLFNTAFVKYGWGWTSILYLPFVTIAFARLDIKKAAPFWFRWLLATLYWYFITQNFVGPSITDRFFTWSG… |
| A0A1Y1WKG4 | 1-136 | None |
| A0A6L5CYV5 | 31-243 | None |
| E5AAM6 | 169-437 | None |
| A0A183HMP1 | 13-210 | None |
| A0A7J6ZIY9 | 20-298 | None |
| A0A1Y2BU58 | 14-230 | None |
| M2SD65 | 43-318 | None |
| A0A0L0S4N0 | 125-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.