DPCstruct | MC59972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 180 ± 25 aa |
| Standard deviation of domain lengths | 24.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377LDB6 | 163-354 | RAWARICLYGDLQRFGRRIDLRVKTGAEAIRALATQLPSFRQKLSDGWYQVRIAGQDVSTSGLTAQLHEALPDGAVIHIVPRVAGAK… |
| G2GXQ7 | 7-141 | SLRTVRLYGKLGHLFGRVHQLAVETPKEAIKALSVILPGFEQFMLQSQSKGLTFAVFNGANNIGKDELASAYGSQDIRIAPVIIGSK… |
| A0A7C7IRN5 | 5-231 | None |
| A0A827H8P8 | 2-151 | None |
| A0A0C6FC94 | 3-176 | None |
| A0A376UBW0 | 72-258 | None |
| A0A1B8P480 | 1-190 | None |
| A0A1Z8Q6E3 | 1-206 | None |
| A0A2E6GYI1 | 2-205 | None |
| A0A0W1GQB9 | 3-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.