DPCstruct | MC59971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 168 ± 24 aa |
| Standard deviation of domain lengths | 23.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4UHI2 | 1-162 | MSDYLVKSVAGNEMFRAYAVDATGVVAEAQQRHDTWSAASAALGRSLVGTLLLASSVLKGDEQMTVKINGNGPVGGIVIDGNAKGTV… |
| A0A377LAQ0 | 2-181 | PQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQM… |
| S9QLW6 | 10-185 | None |
| G6EM17 | 1-179 | None |
| A0A2V2EHI0 | 2-164 | None |
| Q9PCR4 | 4-174 | None |
| A0A0D0Y7E8 | 3-160 | None |
| A0A7I4DAL1 | 95-269 | None |
| A0A2P6NG91 | 39-205 | None |
| A9SDY9 | 428-627 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.