DPCstruct | MC59966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 167 ± 30 aa |
| Standard deviation of domain lengths | 30.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF01314- PF02730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377K7V8 | 8-185 | NILRVNLTTGNITLEDSSKFKSFVGGMGFGYKIMYDEVPPGTKPFDEANKLVFATGPLTGSGAPCSSRVNITSLSTFTKGNLVVDAH… |
| A0A1W2BRB2 | 199-367 | LLVDLTTLTSRQIPLSPKMKQQYIGGKGFGARLLYDLLAPGTDPLGPDNVLMVMTGPLTGTMAPAMRGCIVTKSPLTHTFLDSYFGG… |
| A0A3N1VQ59 | 12-178 | None |
| A0A377DT51 | 217-364 | None |
| A0A7X6XRS6 | 1-190 | None |
| A0A1H0KFG9 | 1-190 | None |
| A0A2H0X7Y3 | 1-174 | None |
| A0A0F2SA08 | 2-148 | None |
| A0A847PGA3 | 2-164 | None |
| A0A3A4VJP3 | 135-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.